For best results, pair this hair treatment with complementary routine essentials (10% Combo Savings).
Product Details: Formulated with advanced Japanese and Southeast Asian hair science, PANTENE Long Strong Shampoo 680ml delivers intensive nourishment directly to hair cuticles and follicles. Developed to counteract humidity, heat damage, and brittleness, this authentic formula restores natural shine, reinforces tensile elasticity, and leaves strands weightlessly smooth and manageable without greasy buildup.
Official authentic formulation with proven restorative and smoothing properties.
Original tamper-evident factory packaging for maximum freshness and stability.
শুধুমাত্র চুল ও মাথার ত্বকে বাহ্যিক ব্যবহারের জন্য প্রযোজ্য। চোখের সংস্পর্শ এড়িয়ে চলুন; চোখে লাগলে তাৎক্ষণিকভাবে পরিষ্কার পানি দিয়ে ধুয়ে ফেলুন। শিশুদের নাগালের বাইরে এবং সরাসরি সূর্যালোক থেকে দূরে শীতল স্থানে সংরক্ষণ করুন।
| Brand | PANTENE |
| SKU | GB-PROD-157329 |
| Category | Hair Care |
| Sourcing Origin | Direct from Kuala Lumpur, Malaysia 🇲🇾 |
| Authenticity | 100% Genuine Counter Stock |
| Delivery Mode | Direct Flight Delivery (10–25 Days) |
| Availability | Pre-Order (10-25 Days) |
Directly sourced from authorized Malaysian flagship counters and official brand distributors. 100% money-back guarantee if proven inauthentic.
Please record a clear, continuous unboxing video from sealed package cutting to product inspection for swift claim resolution and instant support.
50% advance booking on international orders; remaining 50% Cash on Delivery (COD) upon arrival. Dispatched via direct flight from Kuala Lumpur hub.
100% full refund prior to international dispatch. Intact, sealed items eligible for replacement within 3–7 business days. Refund Policy · Delivery Details
Fast delivery by the seller,well packaing with box, received in good condition, no leaking no dented.
Convenient refill pack, Refreshing and invigorating scent, Pleasant and uplifting fragrance
Fast delivery and received in good condition.Good value for money
Hdvehrjtktkfjfbdhshkrlrisyafwcwhekrkegwvshrkro4kevsgehrkrkehwgwgwui3i3gwh3i3gwhej4i483iei
Strengthens hair strands, Protects protein bonds, Smooths hair cuticles, Nice smell too, Easy to use, Safe ingredients. Thank you seller.
Long-lasting hydration, Reduces frizz effectively, Leaves hair manageable, Strengthens hair strands, Protects protein bonds
Reduces frizz effectively, Gentle on scalp, Long-lasting hydration, Strengthens hair strands, Leaves hair manageable
parcel arrived. my feveret scented. thnks seller n miss courier 🌹🌹🌹
![Pantene Shampoo Hair Fall Control 680ml [Bundle of 3]](https://glowbaybd.com/wp-content/uploads/2026/10/pantene-shampoo-hair-fall-control-680ml-bundle-of-3-glowbay-1.webp)
